SCOP 1.71: Domain d1tag_2: 1tag 27-56,178-340

Lineage for d1tag_2 (1tag 27-56,178-340)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (2 species)
   common fold is interrupted with an all-alpha domain

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (13 PDB entries)

8. Domain d1tag_2: 1tag 27-56,178-340 [32080]
   Other proteins in same PDB: d1tag_1
   complexed with gdp, mg

Details for d1tag_2

PDB Entry: 1tag, 1.8 Å

PDB Description: structural determinants for activation of the alpha-subunit of a heterotrimeric g protein

SCOP Domain Sequences for d1tag_2:

Sequence; same for both SEQRES and ATOM records:

>d1tag_2 c.37.1.8 (27-56,178-340) Transducin (alpha subunit) {Cow (Bos taurus)}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiii

Timeline for d1tag_2:

• d1tag_2 first appeared (with stable ids) in SCOP 1.55
  
• d1tag_2 appears in SCOP 1.69
  
• d1tag_2 is called d1taga2 in SCOP 1.73
  
• d1tag_2 appears in the current release, SCOPe 2.08, called d1taga2