| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Transducin (alpha subunit) [52623] (2 species) common fold is interrupted with an all-alpha domain |
| Species Cow (Bos taurus) [TaxId:9913] [52624] (13 PDB entries) |
| Domain d1tadb2: 1tad B:27-56,B:178-342 [32078] Other proteins in same PDB: d1tada1, d1tadb1, d1tadc1 |
PDB Entry: 1tad (more details), 1.7 Å
SCOP Domain Sequences for d1tadb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tadb2 c.37.1.8 (B:27-56,B:178-342) Transducin (alpha subunit) {Cow (Bos taurus)}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiiike
Timeline for d1tadb2:
View in 3DDomains from other chains: (mouse over for more information) d1tada1, d1tada2, d1tadc1, d1tadc2 |