Lineage for d1tada2 (1tad A:27-56,A:178-342)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582325Protein Transducin (alpha subunit) [52623] (2 species)
    common fold is interrupted with an all-alpha domain
  7. 582326Species Cow (Bos taurus) [TaxId:9913] [52624] (13 PDB entries)
  8. 582327Domain d1tada2: 1tad A:27-56,A:178-342 [32077]
    Other proteins in same PDB: d1tada1, d1tadb1, d1tadc1

Details for d1tada2

PDB Entry: 1tad (more details), 1.7 Å

PDB Description: gtpase mechanism of gproteins from the 1.7-angstrom crystal structure of transducin alpha-gdp-alf4-

SCOP Domain Sequences for d1tada2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tada2 c.37.1.8 (A:27-56,A:178-342) Transducin (alpha subunit) {Cow (Bos taurus)}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiiike

SCOP Domain Coordinates for d1tada2:

Click to download the PDB-style file with coordinates for d1tada2.
(The format of our PDB-style files is described here.)

Timeline for d1tada2: