Lineage for d1tadc1 (1tad C:57-177)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540066Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 540067Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 540068Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 540069Protein Transducin (alpha subunit), insertion domain [47897] (2 species)
  7. 540070Species Cow (Bos taurus) [TaxId:9913] [47898] (13 PDB entries)
  8. 540073Domain d1tadc1: 1tad C:57-177 [18196]
    Other proteins in same PDB: d1tada2, d1tadb2, d1tadc2
    complexed with alf, ca, cac, gdp

Details for d1tadc1

PDB Entry: 1tad (more details), 1.7 Å

PDB Description: gtpase mechanism of gproteins from the 1.7-angstrom crystal structure of transducin alpha-gdp-alf4-

SCOP Domain Sequences for d1tadc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tadc1 a.66.1.1 (C:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus)}
ysleeclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmp
kemsdiiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvk
t

SCOP Domain Coordinates for d1tadc1:

Click to download the PDB-style file with coordinates for d1tadc1.
(The format of our PDB-style files is described here.)

Timeline for d1tadc1: