Lineage for d1tada2 (1tad A:27-56,A:178-342)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595281Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 1595282Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries)
    Uniprot P04896 39-388
  8. 1595283Domain d1tada2: 1tad A:27-56,A:178-342 [32077]
    Other proteins in same PDB: d1tada1, d1tadb1, d1tadc1
    complexed with alf, ca, cac, gdp

Details for d1tada2

PDB Entry: 1tad (more details), 1.7 Å

PDB Description: gtpase mechanism of gproteins from the 1.7-angstrom crystal structure of transducin alpha-gdp-alf4-
PDB Compounds: (A:) transducin-alpha

SCOPe Domain Sequences for d1tada2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tada2 c.37.1.8 (A:27-56,A:178-342) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiiike

SCOPe Domain Coordinates for d1tada2:

Click to download the PDB-style file with coordinates for d1tada2.
(The format of our PDB-style files is described here.)

Timeline for d1tada2: