SCOPe 2.04: Domain d1tadc1: 1tad C:57-177

Lineage for d1tadc1 (1tad C:57-177)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries)

8. Domain d1tadc1: 1tad C:57-177 [18196]
   Other proteins in same PDB: d1tada2, d1tadb2, d1tadc2
   complexed with alf, ca, cac, gdp

Details for d1tadc1

PDB Entry: 1tad, 1.7 Å

PDB Description: gtpase mechanism of gproteins from the 1.7-angstrom crystal structure of transducin alpha-gdp-alf4-

PDB Compounds: (C:) transducin-alpha

SCOPe Domain Sequences for d1tadc1:

Sequence; same for both SEQRES and ATOM records:

>d1tadc1 a.66.1.1 (C:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
ysleeclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmp
kemsdiiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvk
t

Timeline for d1tadc1:

• d1tadc1 first appeared (with stable ids) in SCOP 1.55
  
• d1tadc1 appears in SCOPe 2.03
  
• d1tadc1 appears in SCOPe 2.05
  
• d1tadc1 appears in the current release, SCOPe 2.08