SCOPe 2.04: Domain d1ceea_: 1cee A:

Lineage for d1ceea_ (1cee A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (27 PDB entries)

8. Domain d1ceea_: 1cee A: [32072]
   complexed with gcp, mg

Details for d1ceea_

PDB Entry: 1cee

PDB Description: solution structure of cdc42 in complex with the gtpase binding domain of wasp

PDB Compounds: (A:) GTP-binding rho-like protein

SCOPe Domain Sequences for d1ceea_:

Sequence; same for both SEQRES and ATOM records:

>d1ceea_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalep

Timeline for d1ceea_:

• d1ceea_ first appeared (with stable ids) in SCOP 1.55
  
• d1ceea_ appears in SCOPe 2.03
  
• d1ceea_ appears in SCOPe 2.05
  
• d1ceea_ appears in the current release, SCOPe 2.08