Lineage for d1ceea_ (1cee A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.8: G proteins [52592] (20 proteins) 
Protein CDC42 [52619] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52620] (11 PDB entries) 
Domain d1ceea_: 1cee A: [32072]
Details for d1ceea_
PDB Entry: 1cee (more details)
PDB Description: solution structure of cdc42 in complex with the gtpase binding domain of wasp
SCOP Domain Sequences for d1ceea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ceea_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens)}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalep
SCOP Domain Coordinates for d1ceea_:
Click to download the PDB-style file with coordinates for d1ceea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ceea_:
- d1ceea_ appears in SCOP 1.57
- d1ceea_ appears in the current release, SCOPe 2.08
View in 3D