SCOPe 2.07: Domain d5kswd2: 5ksw D:103-262

Lineage for d5kswd2 (5ksw D:103-262)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.3: Dihydroorotate dehydrogenase B, PyrK subunit [52362] (2 proteins)
   contains 2Fe-2S cluster in the C-terminal extension

6. Protein automated matches [320610] (1 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:1360] [320611] (2 PDB entries)

8. Domain d5kswd2: 5ksw D:103-262 [320718]
   Other proteins in same PDB: d5kswa_, d5kswb1, d5kswc_, d5kswd1
   automated match to d1ep3b2
   complexed with cl, edo, fad, fes, fmn; mutant

Details for d5kswd2

PDB Entry: 5ksw, 2.47 Å

PDB Description: dhodb-i74d mutant

PDB Compounds: (D:) Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit

SCOPe Domain Sequences for d5kswd2:

Sequence; same for both SEQRES and ATOM records:

>d5kswd2 c.25.1.3 (D:103-262) automated matches {Lactococcus lactis [TaxId: 1360]}
pvdevvstdkilivgggigvpplyelakqleekncqmtillgfasekvkilekefaelkn
vslkiatddgsygtkghvgmlmeeidfevdalytcgapamlkavakkyeqlerlyismes
rmacgigacyacvehdkedenhalkvcedgpvflgkqlll

Timeline for d5kswd2:

• d5kswd2 first appeared in SCOPe 2.06
  
• d5kswd2 appears in the current release, SCOPe 2.08