Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein CDC42 [52619] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [52620] (34 PDB entries) |
Domain d1a4rb_: 1a4r B: [32064] complexed with gdp, gnh, mg; mutant |
PDB Entry: 1a4r (more details), 2.5 Å
SCOPe Domain Sequences for d1a4rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a4rb_ c.37.1.8 (B:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} mqtikcvvvgdvavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp epkksrrcvl
Timeline for d1a4rb_: