Lineage for d5jhrx_ (5jhr X:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2226421Protein Proteasome beta subunit (catalytic) [56252] (6 species)
  7. 2226430Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (174 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2228222Domain d5jhrx_: 5jhr X: [320487]
    Other proteins in same PDB: d5jhrb_, d5jhrc_, d5jhrd_, d5jhre_, d5jhrf_, d5jhrg_, d5jhrh_, d5jhrm_, d5jhrp_, d5jhrq_, d5jhrr_, d5jhrs_, d5jhrt_, d5jhru_, d5jhrv_
    automated match to d1rypk_
    complexed with 6kf, cl, mes, mg

Details for d5jhrx_

PDB Entry: 5jhr (more details), 2.9 Å

PDB Description: yeast 20s proteasome in complex with the peptidic epoxyketone inhibitor 27
PDB Compounds: (X:) Proteasome subunit beta type-4

SCOPe Domain Sequences for d5jhrx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhrx_ d.153.1.4 (X:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddf

SCOPe Domain Coordinates for d5jhrx_:

Click to download the PDB-style file with coordinates for d5jhrx_.
(The format of our PDB-style files is described here.)

Timeline for d5jhrx_: