SCOP 1.67: Domain d3ranb_: 3ran B:

Lineage for d3ranb_ (3ran B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (37 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [52610] (5 PDB entries)

8. Domain d3ranb_: 3ran B: [32029]

Details for d3ranb_

PDB Entry: 3ran, 2.15 Å

PDB Description: canine gdp-ran q69l mutant

SCOP Domain Sequences for d3ranb_:

Sequence; same for both SEQRES and ATOM records:

>d3ranb_ c.37.1.8 (B:) Ran {Dog (Canis familiaris)}
qgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnv
wdtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnk
vdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampala
ppevvmdpalaaqyehdlevaqtt

Timeline for d3ranb_:

• d3ranb_ first appeared (with stable ids) in SCOP 1.55
  
• d3ranb_ appears in SCOP 1.65
  
• d3ranb_ appears in SCOP 1.69
  
• d3ranb_ appears in the current release, SCOPe 2.08