| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Ran [52609] (2 species) |
| Species Dog (Canis familiaris) [TaxId:9615] [52610] (9 PDB entries) Uniprot P62825 |
| Domain d3ranb_: 3ran B: [32029] complexed with gdp, mg; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3ran (more details), 2.15 Å
SCOPe Domain Sequences for d3ranb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ranb_ c.37.1.8 (B:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
qgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnv
wdtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnk
vdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampala
ppevvmdpalaaqyehdlevaqtt
Timeline for d3ranb_: