Lineage for d5boka_ (5bok A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053226Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2053227Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2053448Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2053449Protein automated matches [190701] (11 species)
    not a true protein
  7. 2053535Species Diaphorobacter sp. [TaxId:1302548] [319937] (3 PDB entries)
  8. 2053536Domain d5boka_: 5bok A: [319955]
    automated match to d3dqya_
    complexed with fe, fes

Details for d5boka_

PDB Entry: 5bok (more details), 2.4 Å

PDB Description: ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d5boka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5boka_ b.33.1.0 (A:) automated matches {Diaphorobacter sp. [TaxId: 1302548]}
enwidaaardevpegdviginivgkeialyevageiyatdntcthgaarmsdgflegrei
ecplhqgrfdvctgkalctpltqdiktypvkienmrvmlkld

SCOPe Domain Coordinates for d5boka_:

Click to download the PDB-style file with coordinates for d5boka_.
(The format of our PDB-style files is described here.)

Timeline for d5boka_: