Class b: All beta proteins [48724] (180 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
Protein automated matches [190701] (13 species) not a true protein |
Species Diaphorobacter sp. [TaxId:1302548] [319937] (2 PDB entries) |
Domain d5boka_: 5bok A: [319955] automated match to d3dqya_ complexed with fe, fes |
PDB Entry: 5bok (more details), 2.4 Å
SCOPe Domain Sequences for d5boka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5boka_ b.33.1.0 (A:) automated matches {Diaphorobacter sp. [TaxId: 1302548]} enwidaaardevpegdviginivgkeialyevageiyatdntcthgaarmsdgflegrei ecplhqgrfdvctgkalctpltqdiktypvkienmrvmlkld
Timeline for d5boka_: