![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) ![]() |
![]() | Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins) |
![]() | Protein PapD [49586] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49587] (15 PDB entries) |
![]() | Domain d5k93a2: 5k93 A:125-216 [319794] Other proteins in same PDB: d5k93a1, d5k93b1 automated match to d3dpaa2 |
PDB Entry: 5k93 (more details), 2.7 Å
SCOPe Domain Sequences for d5k93a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k93a2 b.7.2.1 (A:125-216) PapD {Escherichia coli [TaxId: 562]} nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa nyntpylsyindyggrpvlsficngsrcsvkk
Timeline for d5k93a2: