Lineage for d3dpaa2 (3dpa A:125-218)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.7: C2 domain-like [49561] (5 superfamilies)
sandwich; 8 strands in 2 sheets; greek-key
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) 
Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins) Protein PapD [49586] (1 species) Species Escherichia coli [TaxId:562] [49587] (15 PDB entries) 
Domain d3dpaa2: 3dpa A:125-218 [23205]
Other proteins in same PDB: d3dpaa1
CA-atoms only
Details for d3dpaa2
PDB Entry: 3dpa (more details)
PDB Description: crystal structure of chaperone protein papd reveals an immunoglobulin fold
PDB Compounds: (A:) chaperone protein papdSCOPe Domain Sequences for d3dpaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dpaa2 b.7.2.1 (A:125-218) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvkkek
SCOPe Domain Coordinates for d3dpaa2:
Click to download the PDB-style file with coordinates for d3dpaa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3dpaa2:
- d3dpaa2 first appeared (with stable ids) in SCOP 1.55, called d3dpa_2
- d3dpaa2 appears in SCOPe 2.07
View in 3D
