Lineage for d5k93a2 (5k93 A:125-216)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045100Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045398Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2045399Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 2045450Protein PapD [49586] (1 species)
  7. 2045451Species Escherichia coli [TaxId:562] [49587] (15 PDB entries)
  8. 2045472Domain d5k93a2: 5k93 A:125-216 [319794]
    Other proteins in same PDB: d5k93a1, d5k93b1
    automated match to d3dpaa2

Details for d5k93a2

PDB Entry: 5k93 (more details), 2.7 Å

PDB Description: papd wild-type chaperone
PDB Compounds: (A:) chaperone protein papd

SCOPe Domain Sequences for d5k93a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k93a2 b.7.2.1 (A:125-216) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvkk

SCOPe Domain Coordinates for d5k93a2:

Click to download the PDB-style file with coordinates for d5k93a2.
(The format of our PDB-style files is described here.)

Timeline for d5k93a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5k93a1