SCOPe 2.08: Domain d5cgqb_: 5cgq B:

Lineage for d5cgqb_ (5cgq B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (4 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (66 PDB entries)

8. Domain d5cgqb_: 5cgq B: [319541]
   Other proteins in same PDB: d5cgqa_
   automated match to d1kfjb_
   complexed with bcn, cs, edo, f9f, plp, trp

Details for d5cgqb_

PDB Entry: 5cgq, 1.18 Å

PDB Description: crystal structure of tryptophan synthase from salmonella typhimurium in complex with f9 ligand in the alpha-site and the product l- tryptophan in the beta-site.

PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d5cgqb_:

Sequence; same for both SEQRES and ATOM records:

>d5cgqb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdil

Timeline for d5cgqb_:

• d5cgqb_ first appeared in SCOPe 2.06
  
• d5cgqb_ appears in SCOPe 2.07