SCOPe 2.08: Domain d5cgqa_: 5cgq A:

Lineage for d5cgqa_ (5cgq A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein Trp synthase alpha-subunit [51388] (9 species)

7. Species Salmonella typhimurium [TaxId:90371] [51389] (72 PDB entries)

8. Domain d5cgqa_: 5cgq A: [319465]
   Other proteins in same PDB: d5cgqb_
   automated match to d1k8ya_
   complexed with bcn, cs, edo, f9f, plp, trp

Details for d5cgqa_

PDB Entry: 5cgq, 1.18 Å

PDB Description: crystal structure of tryptophan synthase from salmonella typhimurium in complex with f9 ligand in the alpha-site and the product l- tryptophan in the beta-site.

PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d5cgqa_:

Sequence; same for both SEQRES and ATOM records:

>d5cgqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasra

Timeline for d5cgqa_:

• d5cgqa_ first appeared in SCOPe 2.06
  
• d5cgqa_ appears in SCOPe 2.07