Lineage for d5itqa2 (5itq A:132-246)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348330Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2348331Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2348481Family a.156.1.0: automated matches [254300] (1 protein)
    not a true family
  6. 2348482Protein automated matches [254693] (4 species)
    not a true protein
  7. 2348485Species Human (Homo sapiens) [TaxId:9606] [267977] (2 PDB entries)
  8. 2348486Domain d5itqa2: 5itq A:132-246 [319378]
    Other proteins in same PDB: d5itqa1, d5itqa3
    automated match to d1tdha1
    protein/DNA complex

Details for d5itqa2

PDB Entry: 5itq (more details), 1.48 Å

PDB Description: crystal structure of human neil1, free protein
PDB Compounds: (A:) Endonuclease 8-like 1

SCOPe Domain Sequences for d5itqa2:

Sequence, based on SEQRES records: (download)

>d5itqa2 a.156.1.0 (A:132-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylraeilyrlkippf
ekarsvlealqqhrpspeltlsqkirtklqnpdllelchsvpkevvqlggrgygs

Sequence, based on observed residues (ATOM records): (download)

>d5itqa2 a.156.1.0 (A:132-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylraeilyrlkippf
ekarsvlealqqspeltlsqkirtklqnpdllelchsvpkevvqlggrgygs

SCOPe Domain Coordinates for d5itqa2:

Click to download the PDB-style file with coordinates for d5itqa2.
(The format of our PDB-style files is described here.)

Timeline for d5itqa2: