![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
![]() | Protein automated matches [190463] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187379] (11 PDB entries) |
![]() | Domain d5itqa3: 5itq A:247-290 [319379] Other proteins in same PDB: d5itqa1, d5itqa2 automated match to d1tdha3 protein/DNA complex |
PDB Entry: 5itq (more details), 1.48 Å
SCOPe Domain Sequences for d5itqa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5itqa3 g.39.1.0 (A:247-290) automated matches {Human (Homo sapiens) [TaxId: 9606]} esgeedfaafrawlrcygmpgmsslqdrhgrtiwfqgdpgplap
Timeline for d5itqa3: