Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.3: Chloramphenicol phosphotransferase [52569] (1 protein) similar to the nucleotide/nucleoside kinases but acts on different substrate automatically mapped to Pfam PF07931 |
Protein Chloramphenicol phosphotransferase [52570] (1 species) |
Species Streptomyces venezuelae [TaxId:54571] [52571] (6 PDB entries) |
Domain d1qhxa_: 1qhx A: [31936] complexed with atp, mg |
PDB Entry: 1qhx (more details), 2.5 Å
SCOPe Domain Sequences for d1qhxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} mttrmiilnggssagksgivrclqsvlpepwlafgvdslieamplkmqsaeggiefdadg gvsigpefralegawaegvvamaragariiiddvflggaaaqerwrsfvgdldvlwvgvr cdgavaegretargdrvagmaakqayvvhegveydvevdtthkesiecawaiaahvvp
Timeline for d1qhxa_: