Lineage for d1qhxa_ (1qhx A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23069Family c.37.1.3: Chloramphenicol phosphotransferase [52569] (1 protein)
  6. 23070Protein Chloramphenicol phosphotransferase [52570] (1 species)
  7. 23071Species Streptomyces venezuelae [TaxId:54571] [52571] (4 PDB entries)
  8. 23072Domain d1qhxa_: 1qhx A: [31936]

Details for d1qhxa_

PDB Entry: 1qhx (more details), 2.5 Å

PDB Description: chloramphenicol phosphotransferase in complex with atp from streptomyces venezuelae

SCOP Domain Sequences for d1qhxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae}
mttrmiilnggssagksgivrclqsvlpepwlafgvdslieamplkmqsaeggiefdadg
gvsigpefralegawaegvvamaragariiiddvflggaaaqerwrsfvgdldvlwvgvr
cdgavaegretargdrvagmaakqayvvhegveydvevdtthkesiecawaiaahvvp

SCOP Domain Coordinates for d1qhxa_:

Click to download the PDB-style file with coordinates for d1qhxa_.
(The format of our PDB-style files is described here.)

Timeline for d1qhxa_: