| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein automated matches [227019] (4 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318873] (4 PDB entries) |
| Domain d5a4we1: 5a4w E:2-86 [319217] Other proteins in same PDB: d5a4wa2, d5a4wb2, d5a4wc2, d5a4wd2, d5a4we2, d5a4wf2 automated match to d1gnwa2 complexed with act, qct |
PDB Entry: 5a4w (more details), 2.25 Å
SCOPe Domain Sequences for d5a4we1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a4we1 c.47.1.5 (E:2-86) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
agikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedg
dlklfesraitqyiahryenqgtnl
Timeline for d5a4we1: