Lineage for d5a4wb2 (5a4w B:87-212)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) 
Protein automated matches [226848] (13 species)
not a true protein
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318877] (4 PDB entries) 
Domain d5a4wb2: 5a4w B:87-212 [319187]
Other proteins in same PDB: d5a4wa1, d5a4wb1, d5a4wc1, d5a4wd1, d5a4we1, d5a4wf1
automated match to d1gnwa1
complexed with act, qct
Details for d5a4wb2
PDB Entry: 5a4w (more details), 2.25 Å
PDB Description: atgstf2 from arabidopsis thaliana in complex with quercetrin
PDB Compounds: (B:) glutathione s-transferase f2SCOPe Domain Sequences for d5a4wb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a4wb2 a.45.1.1 (B:87-212) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklak
vldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrp
asekvq
SCOPe Domain Coordinates for d5a4wb2:
Click to download the PDB-style file with coordinates for d5a4wb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5a4wb2:
View in 3D
