Lineage for d5iwla2 (5iwl A:123-233)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024002Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)
  8. 2024335Domain d5iwla2: 5iwl A:123-233 [319067]
    Other proteins in same PDB: d5iwla1, d5iwlb1
    automated match to d1svza1
    complexed with nag, pge

Details for d5iwla2

PDB Entry: 5iwl (more details), 2.8 Å

PDB Description: cd47-diabody complex
PDB Compounds: (A:) 5F9 diabody

SCOPe Domain Sequences for d5iwla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iwla2 b.1.1.1 (A:123-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslpvtpgepasiscrssqsivysngntylgwylqkpgqspqlliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedvgvyycfqgshvpytfgqgtklei

SCOPe Domain Coordinates for d5iwla2:

Click to download the PDB-style file with coordinates for d5iwla2.
(The format of our PDB-style files is described here.)

Timeline for d5iwla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5iwla1