SCOPe 2.08: Domain d5iwla2: 5iwl A:123-233

Lineage for d5iwla2 (5iwl A:123-233)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d5iwla2: 5iwl A:123-233 [319067]
   Other proteins in same PDB: d5iwla1, d5iwlb1
   automated match to d1svza1
   complexed with nag, pge

Details for d5iwla2

PDB Entry: 5iwl, 2.8 Å

PDB Description: cd47-diabody complex

PDB Compounds: (A:) 5F9 diabody

SCOPe Domain Sequences for d5iwla2:

Sequence; same for both SEQRES and ATOM records:

>d5iwla2 b.1.1.1 (A:123-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslpvtpgepasiscrssqsivysngntylgwylqkpgqspqlliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedvgvyycfqgshvpytfgqgtklei

Timeline for d5iwla2:

• d5iwla2 first appeared in SCOPe 2.06
  
• d5iwla2 appears in SCOPe 2.07