Lineage for d5dhyb_ (5dhy B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2371487Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (28 PDB entries)
  8. 2371575Domain d5dhyb_: 5dhy B: [318766]
    automated match to d3t0va_

Details for d5dhyb_

PDB Entry: 5dhy (more details), 3.1 Å

PDB Description: hiv-1 rev ntd dimers with variable crossing angles
PDB Compounds: (B:) Anti-Rev Antibody Fab single-chain variable fragment, light chain

SCOPe Domain Sequences for d5dhyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dhyb_ b.1.1.0 (B:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
elvmtqtpssvsepvggtvtikcqasqsisswlswyqqkpgqppklliydasnlasgvps
rfmgsgsgteytltisgvqredaatyyclggypaasyrtafgggteleii

SCOPe Domain Coordinates for d5dhyb_:

Click to download the PDB-style file with coordinates for d5dhyb_.
(The format of our PDB-style files is described here.)

Timeline for d5dhyb_: