Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d3t0va_: 3t0v A: [216628] automated match to d2e7lc_ complexed with 1pe, edo, pe3, so4, trs |
PDB Entry: 3t0v (more details), 1.45 Å
SCOPe Domain Sequences for d3t0va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t0va_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} epvltqspsvsgtpgqkvtifcsgsssnvednsvywyqqfpgttpkvliynddrrssgvp drfsgsksgtsaslaisglrsedeadyyclswddslngwvfgggtkvtvldaa
Timeline for d3t0va_: