Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) contains two Fe4-S4 clusters |
Family a.1.2.0: automated matches [230426] (1 protein) not a true family |
Protein automated matches [230427] (2 species) not a true protein |
Species Pig roundworm (Ascaris suum) [TaxId:6253] [256142] (8 PDB entries) |
Domain d5c3jb2: 5c3j B:139-282 [318706] Other proteins in same PDB: d5c3jb1, d5c3jf1 automated match to d3vr8b2 complexed with eph, f3s, fad, fes, hem, mli, sf4, uq1 |
PDB Entry: 5c3j (more details), 2.8 Å
SCOPe Domain Sequences for d5c3jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c3jb2 a.1.2.0 (B:139-282) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]} mnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwn adkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnpara igeikmlltkmktkpaplptpanf
Timeline for d5c3jb2: