Lineage for d5c3jb2 (5c3j B:139-282)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2689591Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2689722Family a.1.2.0: automated matches [230426] (1 protein)
    not a true family
  6. 2689723Protein automated matches [230427] (2 species)
    not a true protein
  7. 2689728Species Pig roundworm (Ascaris suum) [TaxId:6253] [256142] (8 PDB entries)
  8. 2689733Domain d5c3jb2: 5c3j B:139-282 [318706]
    Other proteins in same PDB: d5c3jb1, d5c3jf1
    automated match to d3vr8b2
    complexed with eph, f3s, fad, fes, hem, mli, sf4, uq1

Details for d5c3jb2

PDB Entry: 5c3j (more details), 2.8 Å

PDB Description: crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with ubiquinone-1
PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d5c3jb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c3jb2 a.1.2.0 (B:139-282) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
mnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwn
adkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnpara
igeikmlltkmktkpaplptpanf

SCOPe Domain Coordinates for d5c3jb2:

Click to download the PDB-style file with coordinates for d5c3jb2.
(The format of our PDB-style files is described here.)

Timeline for d5c3jb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5c3jb1