Lineage for d4ztte1 (4ztt E:2-163)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.25: Ferritin-like [47239] (6 superfamilies)
core: 4 helices; bundle, closed, left-handed twist; 1 crossover connectionSuperfamily a.25.1: Ferritin-like [47240] (10 families) 
contains bimetal-ion centre in the middle of the bundle
Family a.25.1.1: Ferritin [47241] (10 proteins) Protein automated matches [190041] (34 species)
not a true protein
Species Escherichia coli [TaxId:536056] [318611] (1 PDB entry) 
Domain d4ztte1: 4ztt E:2-163 [318615]
Other proteins in same PDB: d4zttb2, d4ztte2, d4zttf2
automated match to d4reua_
complexed with fe, fe2, feo, gol, o, oh, oxy, per; mutant
Details for d4ztte1
PDB Entry: 4ztt (more details), 1.83 Å
PDB Description: crystal structures of ferritin mutants reveal diferric-peroxo intermediates
PDB Compounds: (E:) Bacterial non-heme ferritinSCOPe Domain Sequences for d4ztte1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ztte1 a.25.1.1 (E:2-163) automated matches {Escherichia coli [TaxId: 536056]}
lkpemieklneqmnlelyasllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstldt
SCOPe Domain Coordinates for d4ztte1:
Click to download the PDB-style file with coordinates for d4ztte1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ztte1:
View in 3D
