Lineage for d4ztte1 (4ztt E:2-163)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702456Species Escherichia coli [TaxId:536056] [318611] (1 PDB entry)
  8. 2702461Domain d4ztte1: 4ztt E:2-163 [318615]
    Other proteins in same PDB: d4zttb2, d4ztte2, d4zttf2
    automated match to d4reua_
    complexed with fe, fe2, feo, gol, o, oh, oxy, per; mutant

Details for d4ztte1

PDB Entry: 4ztt (more details), 1.83 Å

PDB Description: crystal structures of ferritin mutants reveal diferric-peroxo intermediates
PDB Compounds: (E:) Bacterial non-heme ferritin

SCOPe Domain Sequences for d4ztte1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ztte1 a.25.1.1 (E:2-163) automated matches {Escherichia coli [TaxId: 536056]}
lkpemieklneqmnlelyasllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstldt

SCOPe Domain Coordinates for d4ztte1:

Click to download the PDB-style file with coordinates for d4ztte1.
(The format of our PDB-style files is described here.)

Timeline for d4ztte1: