Class b: All beta proteins [48724] (177 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein automated matches [190608] (4 species) not a true protein |
Species Clostridium botulinum [TaxId:1491] [230685] (7 PDB entries) |
Domain d5b2ha2: 5b2h A:149-285 [318580] automated match to d2e4ma2 complexed with pge |
PDB Entry: 5b2h (more details), 2.2 Å
SCOPe Domain Sequences for d5b2ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b2ha2 b.42.2.1 (A:149-285) automated matches {Clostridium botulinum [TaxId: 1491]} nstckiqtsltikfidknqnsnnvtiwswnngdnqkwkilyneskmaytltciknneylt wfssignnvgtyrtegnndqywfinylnndasmytisnfsnqskfldvvnsgladgtnvq vwdsngtsaqkwiitrl
Timeline for d5b2ha2: