Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.12: PFOR PP module [88771] (1 protein) domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains |
Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI [88772] (1 species) |
Species Desulfovibrio africanus [TaxId:873] [88773] (10 PDB entries) |
Domain d2pdab2: 2pda B:786-1232 [31838] Other proteins in same PDB: d2pdaa1, d2pdaa3, d2pdaa4, d2pdaa5, d2pdab1, d2pdab3, d2pdab4, d2pdab5 complexed with ca, mg, pyr, sf4, tpp |
PDB Entry: 2pda (more details), 3 Å
SCOPe Domain Sequences for d2pdab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pdab2 c.36.1.12 (B:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]} vksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcssiwg asapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesdasgd vkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifggdgw aydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtgkkdl armvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmgksqd vmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsfpeda krlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtpmmar pdsgeacdqnragtseqqgdlskrtkk
Timeline for d2pdab2: