SCOPe 2.07: Domain d5jscc2: 5jsc C:240-398

Lineage for d5jscc2 (5jsc C:240-398)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (30 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [318235] (1 PDB entry)

8. Domain d5jscc2: 5jsc C:240-398 [318346]
   Other proteins in same PDB: d5jsca1, d5jscb1, d5jscc1, d5jscd1
   automated match to d5idua2
   complexed with cl, edo, fad, so4

Details for d5jscc2

PDB Entry: 5jsc, 1.5 Å

PDB Description: crystal structure of a putative acyl-coa dehydrogenase from burkholderia xenovorans

PDB Compounds: (C:) putative acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5jscc2:

Sequence; same for both SEQRES and ATOM records:

>d5jscc2 a.29.3.0 (C:240-398) automated matches {Burkholderia xenovorans [TaxId: 266265]}
gegfklamrtldifrtsvaaaslgfarhamaegvaraasrkmfgqtlgdfqltqaklaqm
altidssallvyraawlrdqgenvtreaamakwhasegaqqvidaavqlyggmgvqsgta
vemlyreiralriyegatevqqlivgrdllkahaaatag

Timeline for d5jscc2:

• d5jscc2 first appeared in SCOPe 2.06
  
• d5jscc2 appears in the current release, SCOPe 2.08