![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
![]() | Protein automated matches [226935] (30 species) not a true protein |
![]() | Species Burkholderia xenovorans [TaxId:266265] [318235] (1 PDB entry) |
![]() | Domain d5jscc2: 5jsc C:240-398 [318346] Other proteins in same PDB: d5jsca1, d5jscb1, d5jscc1, d5jscd1 automated match to d5idua2 complexed with cl, edo, fad, so4 |
PDB Entry: 5jsc (more details), 1.5 Å
SCOPe Domain Sequences for d5jscc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jscc2 a.29.3.0 (C:240-398) automated matches {Burkholderia xenovorans [TaxId: 266265]} gegfklamrtldifrtsvaaaslgfarhamaegvaraasrkmfgqtlgdfqltqaklaqm altidssallvyraawlrdqgenvtreaamakwhasegaqqvidaavqlyggmgvqsgta vemlyreiralriyegatevqqlivgrdllkahaaatag
Timeline for d5jscc2: