SCOPe 2.08: Domain d1qs0b1: 1qs0 B:2-205

Lineage for d1qs0b1 (1qs0 B:2-205)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
   automatically mapped to Pfam PF02779

6. Protein 2-oxoisovalerate dehydrogenase (E1B), Pyr module [88744] (1 species)
   chain A is alpha-subunit and chain B is beta-subunit

7. Species Pseudomonas putida [TaxId:303] [88745] (1 PDB entry)

8. Domain d1qs0b1: 1qs0 B:2-205 [31830]
   Other proteins in same PDB: d1qs0a_, d1qs0b2
   complexed with coi, mg, tdp

Details for d1qs0b1

PDB Entry: 1qs0, 2.4 Å

PDB Description: crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b)

PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta-subunit

SCOPe Domain Sequences for d1qs0b1:

Sequence; same for both SEQRES and ATOM records:

>d1qs0b1 c.36.1.7 (B:2-205) 2-oxoisovalerate dehydrogenase (E1B), Pyr module {Pseudomonas putida [TaxId: 303]}
atttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapis
esgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmpc
gggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyng
pfdghhdrpvtpwskhphsavpdg

Timeline for d1qs0b1:

• d1qs0b1 first appeared (with stable ids) in SCOP 1.55
  
• d1qs0b1 appears in SCOPe 2.07