Lineage for d1qs0b1 (1qs0 B:2-205)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22854Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 22855Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 22922Family c.36.1.3: Branched-chain alpha-keto acid dehydrogenase [52531] (2 proteins)
  6. 22923Protein 2-oxoisovalerate dehydrogenase, E1B [52534] (1 species)
  7. 22924Species Pseudomonas putida [TaxId:303] [52535] (1 PDB entry)
  8. 22926Domain d1qs0b1: 1qs0 B:2-205 [31830]
    Other proteins in same PDB: d1qs0b2

Details for d1qs0b1

PDB Entry: 1qs0 (more details), 2.4 Å

PDB Description: crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b)

SCOP Domain Sequences for d1qs0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qs0b1 c.36.1.3 (B:2-205) 2-oxoisovalerate dehydrogenase, E1B {Pseudomonas putida}
atttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapis
esgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmpc
gggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyng
pfdghhdrpvtpwskhphsavpdg

SCOP Domain Coordinates for d1qs0b1:

Click to download the PDB-style file with coordinates for d1qs0b1.
(The format of our PDB-style files is described here.)

Timeline for d1qs0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qs0b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1qs0a1