Lineage for d5k0zb2 (5k0z B:160-331)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232537Protein Lactate dehydrogenase [56339] (19 species)
  7. 2232596Species Gallus gallus [TaxId:9031] [318261] (1 PDB entry)
  8. 2232598Domain d5k0zb2: 5k0z B:160-331 [318281]
    Other proteins in same PDB: d5k0za1, d5k0zb1, d5k0zc1, d5k0zd1
    automated match to d1i0za2

Details for d5k0zb2

PDB Entry: 5k0z (more details), 2.8 Å

PDB Description: cryo-em structure of lactate dehydrogenase (ldh) in inhibitor-bound state
PDB Compounds: (B:) L-lactate dehydrogenase B chain

SCOPe Domain Sequences for d5k0zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k0zb2 d.162.1.1 (B:160-331) Lactate dehydrogenase {Gallus gallus [TaxId: 9031]}
sgcnldtarfrylmaerlgihptschgwilgehgdssvavwsgvnvagvslqelnpamgt
dkdsenwkevhkqvvesayevirlkgytnwaiglsvaelcetmlknlyrvhsvstlvkgt
ygiendvflslpcvlsasgltsvinqklkddevaqlkksadtlwsiqkdlkd

SCOPe Domain Coordinates for d5k0zb2:

Click to download the PDB-style file with coordinates for d5k0zb2.
(The format of our PDB-style files is described here.)

Timeline for d5k0zb2: