Lineage for d5k0zb1 (5k0z B:1-159)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105555Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2105594Protein Lactate dehydrogenase [51859] (18 species)
  7. 2105648Species Gallus gallus [TaxId:9031] [318259] (1 PDB entry)
  8. 2105650Domain d5k0zb1: 5k0z B:1-159 [318280]
    Other proteins in same PDB: d5k0za2, d5k0zb2, d5k0zc2, d5k0zd2
    automated match to d1i0za1

Details for d5k0zb1

PDB Entry: 5k0z (more details), 2.8 Å

PDB Description: cryo-em structure of lactate dehydrogenase (ldh) in inhibitor-bound state
PDB Compounds: (B:) L-lactate dehydrogenase B chain

SCOPe Domain Sequences for d5k0zb1:

Sequence, based on SEQRES records: (download)

>d5k0zb1 c.2.1.5 (B:1-159) Lactate dehydrogenase {Gallus gallus [TaxId: 9031]}
atlkeklitpvaagstvpsnkitvvgvgqvgmacaisilgkglcdelalvdvledklkge
mmdlqhgslflqthkivadkdyavtanskivvvtagvrqqegesrlnlvqrnvnvfkfii
pqivkyspnctilvvsnpvdiltyvtwklsglpkhrvig

Sequence, based on observed residues (ATOM records): (download)

>d5k0zb1 c.2.1.5 (B:1-159) Lactate dehydrogenase {Gallus gallus [TaxId: 9031]}
atlkeklitpvtvpsnkitvvgvgqvgmacaisilgkglcdelalvdvledklkgemmdl
qhgslflqthkivadkdyavtanskivvvtagvlvqrnvnvfkfiipqivkyspnctilv
vsnpvdiltyvtwklsglpkhrvig

SCOPe Domain Coordinates for d5k0zb1:

Click to download the PDB-style file with coordinates for d5k0zb1.
(The format of our PDB-style files is described here.)

Timeline for d5k0zb1: