Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Coagulation factor IXa, protease domain [50583] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50585] (16 PDB entries) |
Domain d5jbas_: 5jba S: [318013] Other proteins in same PDB: d5jbae_ automated match to d2wpis_ complexed with 0g6, ca, dms |
PDB Entry: 5jba (more details), 1.4 Å
SCOPe Domain Sequences for d5jbas_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jbas_ b.47.1.2 (S:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} ivggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee tehteqkrnviriiphhnynaaintynhdialleldeplvlnsyvtpiciadkeytnifl kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftitnnmfcagfheggrds cqgdsggphvtevegtsfltgviswgeecamkgkygiytkvsryvnwikektklt
Timeline for d5jbas_: