SCOPe 2.06: Domain d5jbas_: 5jba S:

Lineage for d5jbas_ (5jba S:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Coagulation factor IXa, protease domain [50583] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50585] (16 PDB entries)

8. Domain d5jbas_: 5jba S: [318013]
   Other proteins in same PDB: d5jbae_
   automated match to d2wpis_
   complexed with 0g6, ca, dms

Details for d5jbas_

PDB Entry: 5jba, 1.4 Å

PDB Description: crystal structure of factor ixa variant v16i k98t y177t i212v in complex with ppack

PDB Compounds: (S:) coagulation factor ix

SCOPe Domain Sequences for d5jbas_:

Sequence; same for both SEQRES and ATOM records:

>d5jbas_ b.47.1.2 (S:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
ivggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaaintynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftitnnmfcagfheggrds
cqgdsggphvtevegtsfltgviswgeecamkgkygiytkvsryvnwikektklt

Timeline for d5jbas_:

• d5jbas_ is new in SCOPe 2.06-stable
  
• d5jbas_ appears in SCOPe 2.07
  
• d5jbas_ appears in the current release, SCOPe 2.08