Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
Protein Pyruvate oxidase [88754] (2 species) |
Species Lactobacillus plantarum [TaxId:1590] [88755] (7 PDB entries) |
Domain d1powb3: 1pow B:366-593 [31800] Other proteins in same PDB: d1powa1, d1powa2, d1powb1, d1powb2 complexed with fad, mg, tpp; mutant |
PDB Entry: 1pow (more details), 2.5 Å
SCOPe Domain Sequences for d1powb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1powb3 c.36.1.9 (B:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} kqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvg ipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqe dtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavit gdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd
Timeline for d1powb3: