Lineage for d1powb2 (1pow B:9-182)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 986456Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 986457Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 986458Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
  6. 986579Protein Pyruvate oxidase [88729] (2 species)
  7. 986585Species Lactobacillus plantarum [TaxId:1590] [88730] (7 PDB entries)
  8. 986599Domain d1powb2: 1pow B:9-182 [31799]
    Other proteins in same PDB: d1powa1, d1powa3, d1powb1, d1powb3
    complexed with fad, mg, tpp; mutant

Details for d1powb2

PDB Entry: 1pow (more details), 2.5 Å

PDB Description: the refined structures of a stabilized mutant and of wild-type pyruvate oxidase from lactobacillus plantarum
PDB Compounds: (B:) Pyruvate oxidase

SCOPe Domain Sequences for d1powb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1powb2 c.36.1.5 (B:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedw

SCOPe Domain Coordinates for d1powb2:

Click to download the PDB-style file with coordinates for d1powb2.
(The format of our PDB-style files is described here.)

Timeline for d1powb2: