Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein automated matches [190384] (21 species) not a true protein |
Species Enterovirus a71 [TaxId:39054] [279546] (12 PDB entries) |
Domain d5c20a1: 5c20 A:1-180 [317904] Other proteins in same PDB: d5c20a2 automated match to d2vb0a_ complexed with ghz |
PDB Entry: 5c20 (more details), 2.75 Å
SCOPe Domain Sequences for d5c20a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c20a1 b.47.1.4 (A:1-180) automated matches {Enterovirus a71 [TaxId: 39054]} gpsldfalsllrrnvrqvqtdqghftmlgvrdrlavlprhsqpgktiwiehklvnildav elvdeqgvnleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvv qygflnlsgkpthrtmmynfptkagqcggvvtsvgkvigihiggngrqgfcaglkrsyfa
Timeline for d5c20a1: