Lineage for d5c20a1 (5c20 A:1-180)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797935Protein automated matches [190384] (21 species)
    not a true protein
  7. 2797942Species Enterovirus a71 [TaxId:39054] [279546] (12 PDB entries)
  8. 2797957Domain d5c20a1: 5c20 A:1-180 [317904]
    Other proteins in same PDB: d5c20a2
    automated match to d2vb0a_
    complexed with ghz

Details for d5c20a1

PDB Entry: 5c20 (more details), 2.75 Å

PDB Description: crystal structure of ev71 3c proteinase in complex with compound 2
PDB Compounds: (A:) 3C proteinase

SCOPe Domain Sequences for d5c20a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c20a1 b.47.1.4 (A:1-180) automated matches {Enterovirus a71 [TaxId: 39054]}
gpsldfalsllrrnvrqvqtdqghftmlgvrdrlavlprhsqpgktiwiehklvnildav
elvdeqgvnleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvv
qygflnlsgkpthrtmmynfptkagqcggvvtsvgkvigihiggngrqgfcaglkrsyfa

SCOPe Domain Coordinates for d5c20a1:

Click to download the PDB-style file with coordinates for d5c20a1.
(The format of our PDB-style files is described here.)

Timeline for d5c20a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5c20a2