SCOPe 2.07: Domain d5fkac1: 5fka C:10-120

Lineage for d5fkac1 (5fka C:10-120)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225054] (10 PDB entries)

8. Domain d5fkac1: 5fka C:10-120 [317841]
   Other proteins in same PDB: d5fkaa1, d5fkaa2, d5fkab1, d5fkab2, d5fkac2
   automated match to d1esfa1
   complexed with zn

Details for d5fkac1

PDB Entry: 5fka, 2.4 Å

PDB Description: crystal structure of staphylococcal enterotoxin e in complex with a t cell receptor

PDB Compounds: (C:) staphylococcal enterotoxin e

SCOPe Domain Sequences for d5fkac1:

Sequence, based on SEQRES records:

>d5fkac1 b.40.2.0 (C:10-120) automated matches {Staphylococcus aureus [TaxId: 1280]}
kdlrkkselqrnalsnlrqiyyynekaitenkesddqflentllfkgfftghpwyndllv
dlgskdatnkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

Sequence, based on observed residues (ATOM records):

>d5fkac1 b.40.2.0 (C:10-120) automated matches {Staphylococcus aureus [TaxId: 1280]}
kdlrkkselqrnalsnlrqiyyynekaitenkesddqflentllfkgfftghpwyndllv
dlgskdatnkykgkkvdlygayygyqcagnktacmyggvtlhdnnrlt

Timeline for d5fkac1:

• d5fkac1 first appeared in SCOPe 2.06
  
• d5fkac1 appears in the current release, SCOPe 2.08