SCOPe 2.07: Domain d5jcga1: 5jcg A:1-194

Lineage for d5jcga1 (5jcg A:1-194)

Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (24 families)
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
Protein automated matches [190100] (20 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187259] (20 PDB entries)
Domain d5jcga1: 5jcg A:1-194 [317815]
Other proteins in same PDB: d5jcga2, d5jcgb2, d5jcgc2, d5jcgd2, d5jcge2, d5jcgf2, d5jcgg2, d5jcgh2, d5jcgi2
automated match to d3tkra_

Details for d5jcga1

PDB Entry: 5jcg (more details), 2.8 Å

PDB Description: structure of human peroxiredoxin 3 as three stacked rings

PDB Compounds: (A:) Thioredoxin-dependent peroxide reductase, mitochondrial

SCOPe Domain Sequences for d5jcga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jcga1 c.47.1.10 (A:1-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apavtqhapyfkgtavvngefkdlslddfkgkylvlffypldftfvcpteivafsdkane
fhdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegsgl
alrglfiidpngvikhlsvndlpvgrsveetlrlvkafqyvethgevcpanwtpdsptik
pspaaskeyfqkvn

SCOPe Domain Coordinates for d5jcga1:

Click to download the PDB-style file with coordinates for d5jcga1.
(The format of our PDB-style files is described here.)

Timeline for d5jcga1: