| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein automated matches [190100] (21 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187259] (21 PDB entries) |
| Domain d5jcga1: 5jcg A:1-194 [317815] Other proteins in same PDB: d5jcga2, d5jcgb2, d5jcgc2, d5jcgd2, d5jcge2, d5jcgf2, d5jcgg2, d5jcgh2, d5jcgi2 automated match to d3tkra_ |
PDB Entry: 5jcg (more details), 2.8 Å
SCOPe Domain Sequences for d5jcga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jcga1 c.47.1.10 (A:1-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apavtqhapyfkgtavvngefkdlslddfkgkylvlffypldftfvcpteivafsdkane
fhdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegsgl
alrglfiidpngvikhlsvndlpvgrsveetlrlvkafqyvethgevcpanwtpdsptik
pspaaskeyfqkvn
Timeline for d5jcga1: