Lineage for d5jcga1 (5jcg A:1-194)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2878164Species Human (Homo sapiens) [TaxId:9606] [187259] (21 PDB entries)
  8. 2878265Domain d5jcga1: 5jcg A:1-194 [317815]
    Other proteins in same PDB: d5jcga2, d5jcgb2, d5jcgc2, d5jcgd2, d5jcge2, d5jcgf2, d5jcgg2, d5jcgh2, d5jcgi2
    automated match to d3tkra_

Details for d5jcga1

PDB Entry: 5jcg (more details), 2.8 Å

PDB Description: structure of human peroxiredoxin 3 as three stacked rings
PDB Compounds: (A:) Thioredoxin-dependent peroxide reductase, mitochondrial

SCOPe Domain Sequences for d5jcga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jcga1 c.47.1.10 (A:1-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apavtqhapyfkgtavvngefkdlslddfkgkylvlffypldftfvcpteivafsdkane
fhdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegsgl
alrglfiidpngvikhlsvndlpvgrsveetlrlvkafqyvethgevcpanwtpdsptik
pspaaskeyfqkvn

SCOPe Domain Coordinates for d5jcga1:

Click to download the PDB-style file with coordinates for d5jcga1.
(The format of our PDB-style files is described here.)

Timeline for d5jcga1: