SCOPe 2.08: Domain d5bzdc2: 5bzd C:107-214

Lineage for d5bzdc2 (5bzd C:107-214)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d5bzdc2: 5bzd C:107-214 [317694]
Other proteins in same PDB: d5bzda1, d5bzdb1, d5bzdb2, d5bzdc1, d5bzdd1, d5bzdd2
automated match to d1dn0a2
complexed with gol

Details for d5bzdc2

PDB Entry: 5bzd (more details), 2.7 Å

PDB Description: crystal structure of pcdn-27a, an antibody from the pcdn family of hiv-1 antibodies

PDB Compounds: (C:) 5G8 HIV Antibody light chain

SCOPe Domain Sequences for d5bzdc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bzdc2 b.1.1.2 (C:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d5bzdc2:

Click to download the PDB-style file with coordinates for d5bzdc2.
(The format of our PDB-style files is described here.)

Timeline for d5bzdc2: